Human LMP1 protein

Produktübersicht

• Artikelname: Human LMP1 protein
• Artikelnummer: BYT-ORB418896
• Hersteller Artikelnummer: orb418896
• Alternativnummer: BYT-ORB418896-20,BYT-ORB418896-100,BYT-ORB418896-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein p63

Produktbeschreibung

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 20.8 kDa
• UniProt: P0C741
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 185-366aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) LMP1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) LMP1.