Human LMP1 protein

Catalog Number: BYT-ORB418896
Article Name: Human LMP1 protein
Biozol Catalog Number: BYT-ORB418896
Supplier Catalog Number: orb418896
Alternative Catalog Number: BYT-ORB418896-20,BYT-ORB418896-100,BYT-ORB418896-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein p63
This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 20.8 kDa
UniProt: P0C741
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Application Notes: Biological Origin: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 185-366aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) LMP1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) LMP1.