Human LMP1 protein
Catalog Number:
BYT-ORB418896
- Images (3)
| Article Name: | Human LMP1 protein |
| Biozol Catalog Number: | BYT-ORB418896 |
| Supplier Catalog Number: | orb418896 |
| Alternative Catalog Number: | BYT-ORB418896-20,BYT-ORB418896-100,BYT-ORB418896-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Protein p63 |
| This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 20.8 kDa |
| UniProt: | P0C741 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
| Application Notes: | Biological Origin: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 185-366aaSequence Info: Full Length |



