Mouse HNRNPA2B1 protein

Artikelnummer: BYT-ORB418907
Artikelname: Mouse HNRNPA2B1 protein
Artikelnummer: BYT-ORB418907
Hersteller Artikelnummer: orb418907
Alternativnummer: BYT-ORB418907-1,BYT-ORB418907-100,BYT-ORB418907-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: hnRNP A2/B1
This Mouse HNRNPA2B1 protein spans the amino acid sequence from region 1-353aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 57.4 kDa
UniProt: O88569
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-353aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.