Mouse HNRNPA2B1 protein

Catalog Number: BYT-ORB418907
Article Name: Mouse HNRNPA2B1 protein
Biozol Catalog Number: BYT-ORB418907
Supplier Catalog Number: orb418907
Alternative Catalog Number: BYT-ORB418907-1,BYT-ORB418907-100,BYT-ORB418907-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: hnRNP A2/B1
This Mouse HNRNPA2B1 protein spans the amino acid sequence from region 1-353aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 57.4 kDa
UniProt: O88569
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-353aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.