Snake venom metalloproteinase adamalysin-2 protein

Produktübersicht

• Artikelname: Snake venom metalloproteinase adamalysin-2 protein
• Artikelnummer: BYT-ORB418920
• Hersteller Artikelnummer: orb418920
• Alternativnummer: BYT-ORB418920-1,BYT-ORB418920-100,BYT-ORB418920-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Adamalysin II Proteinase II

Produktbeschreibung

This Snake venom metalloproteinase adamalysin-2 protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 27.1 kDa
• UniProt: P34179
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Crotalus adamanteus (Eastern diamondback rattlesnake)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Crotalus adamanteus (Eastern diamondback rattlesnake). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.