Snake venom metalloproteinase adamalysin-2 protein

Catalog Number: BYT-ORB418920
Article Name: Snake venom metalloproteinase adamalysin-2 protein
Biozol Catalog Number: BYT-ORB418920
Supplier Catalog Number: orb418920
Alternative Catalog Number: BYT-ORB418920-1,BYT-ORB418920-100,BYT-ORB418920-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Adamalysin II Proteinase II
This Snake venom metalloproteinase adamalysin-2 protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.1 kDa
UniProt: P34179
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Crotalus adamanteus (Eastern diamondback rattlesnake)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Application Notes: Biological Origin: Crotalus adamanteus (Eastern diamondback rattlesnake). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.