Human SLC5A2 protein

Artikelnummer: BYT-ORB418932
Artikelname: Human SLC5A2 protein
Artikelnummer: BYT-ORB418932
Hersteller Artikelnummer: orb418932
Alternativnummer: BYT-ORB418932-1,BYT-ORB418932-100,BYT-ORB418932-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
This Human SLC5A2 protein spans the amino acid sequence from region 1-102aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 15.5 kDa
UniProt: P31639
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-102aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.