Human SLC5A2 protein

Product Overview

• Article Name: Human SLC5A2 protein
• Biozol Catalog Number: BYT-ORB418932
• Supplier Catalog Number: orb418932
• Alternative Catalog Number: BYT-ORB418932-1,BYT-ORB418932-100,BYT-ORB418932-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

Product Description

This Human SLC5A2 protein spans the amino acid sequence from region 1-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 15.5 kDa
• UniProt: P31639
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-102aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.