Bacterial CAF1 protein

Artikelnummer: BYT-ORB418933
Artikelname: Bacterial CAF1 protein
Artikelnummer: BYT-ORB418933
Hersteller Artikelnummer: orb418933
Alternativnummer: BYT-ORB418933-1,BYT-ORB418933-100,BYT-ORB418933-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen
This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.6 kDa
UniProt: P26948
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yersinia pestis
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Anwendungsbeschreibung: Biological Origin: Yersinia pestis. Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.