Bacterial CAF1 protein

Product Overview

• Article Name: Bacterial CAF1 protein
• Biozol Catalog Number: BYT-ORB418933
• Supplier Catalog Number: orb418933
• Alternative Catalog Number: BYT-ORB418933-1,BYT-ORB418933-100,BYT-ORB418933-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

Product Description

This Bacterial CAF1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 19.6 kDa
• UniProt: P26948
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yersinia pestis
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Application Notes

• Application Notes: Biological Origin: Yersinia pestis. Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 22-170aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.