Bacterial RECR protein

Produktübersicht

• Artikelname: Bacterial RECR protein
• Artikelnummer: BYT-ORB418942
• Hersteller Artikelnummer: orb418942
• Alternativnummer: BYT-ORB418942-1,BYT-ORB418942-100,BYT-ORB418942-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: recR, MRA_3752, Recombination protein RecR

Produktbeschreibung

This Bacterial RECR protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 26.1 kDa
• UniProt: A5U941
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.