Bacterial RECR protein

Catalog Number: BYT-ORB418942
Article Name: Bacterial RECR protein
Biozol Catalog Number: BYT-ORB418942
Supplier Catalog Number: orb418942
Alternative Catalog Number: BYT-ORB418942-1,BYT-ORB418942-100,BYT-ORB418942-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: recR, MRA_3752, Recombination protein RecR
This Bacterial RECR protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.1 kDa
UniProt: A5U941
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA
Application Notes: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.