Human WNT2 protein

Artikelnummer: BYT-ORB418947
Artikelname: Human WNT2 protein
Artikelnummer: BYT-ORB418947
Hersteller Artikelnummer: orb418947
Alternativnummer: BYT-ORB418947-1,BYT-ORB418947-100,BYT-ORB418947-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Int-1-like protein 1 Int-1-related protein
This Human WNT2 protein spans the amino acid sequence from region 26-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.6 kDa
UniProt: P09544
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 26-360aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.