Human WNT2 protein

Product Overview

• Article Name: Human WNT2 protein
• Biozol Catalog Number: BYT-ORB418947
• Supplier Catalog Number: orb418947
• Alternative Catalog Number: BYT-ORB418947-1,BYT-ORB418947-100,BYT-ORB418947-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Int-1-like protein 1 Int-1-related protein

Product Description

This Human WNT2 protein spans the amino acid sequence from region 26-360aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 41.6 kDa
• UniProt: P09544
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 26-360aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.