Mouse CES1C protein

Artikelnummer: BYT-ORB418954
Artikelname: Mouse CES1C protein
Artikelnummer: BYT-ORB418954
Hersteller Artikelnummer: orb418954
Alternativnummer: BYT-ORB418954-1,BYT-ORB418954-100,BYT-ORB418954-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Liver carboxylesterase N Lung surfactant convertase PES-N
This Mouse CES1C protein spans the amino acid sequence from region 19-550aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.6 kDa
UniProt: P23953
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQC
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: NO-taggedExpression Region: 19-550aaSequence Info: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.