Mouse CES1C protein

Catalog Number: BYT-ORB418954
Article Name: Mouse CES1C protein
Biozol Catalog Number: BYT-ORB418954
Supplier Catalog Number: orb418954
Alternative Catalog Number: BYT-ORB418954-1,BYT-ORB418954-100,BYT-ORB418954-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Liver carboxylesterase N Lung surfactant convertase PES-N
This Mouse CES1C protein spans the amino acid sequence from region 19-550aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.6 kDa
UniProt: P23953
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQC
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: NO-taggedExpression Region: 19-550aaSequence Info: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.