Fungi HFB2 protein
Artikelnummer:
BYT-ORB418991
- Bilder (3)
| Artikelname: | Fungi HFB2 protein |
| Artikelnummer: | BYT-ORB418991 |
| Hersteller Artikelnummer: | orb418991 |
| Alternativnummer: | BYT-ORB418991-20,BYT-ORB418991-100,BYT-ORB418991-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Hydrophobin II |
| This Fungi HFB2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 9.2 kDa |
| UniProt: | P79073 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Hypocrea jecorina (Trichoderma reesei) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF |
| Anwendungsbeschreibung: | Biological Origin: Hypocrea jecorina (Trichoderma reesei). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 16-86aaSequence Info: Partial |



