Fungi HFB2 protein

Product Overview

• Article Name: Fungi HFB2 protein
• Biozol Catalog Number: BYT-ORB418991
• Supplier Catalog Number: orb418991
• Alternative Catalog Number: BYT-ORB418991-20,BYT-ORB418991-100,BYT-ORB418991-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Hydrophobin II

Product Description

This Fungi HFB2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 9.2 kDa
• UniProt: P79073
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Hypocrea jecorina (Trichoderma reesei)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Application Notes

• Application Notes: Biological Origin: Hypocrea jecorina (Trichoderma reesei). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 16-86aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hypocrea jecorina (Trichoderma reesei) hfb2.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hypocrea jecorina (Trichoderma reesei) hfb2.