Bacterial DINB protein

Artikelnummer: BYT-ORB419075
Artikelname: Bacterial DINB protein
Artikelnummer: BYT-ORB419075
Hersteller Artikelnummer: orb419075
Alternativnummer: BYT-ORB419075-20,BYT-ORB419075-100,BYT-ORB419075-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7
This Bacterial DINB protein spans the amino acid sequence from region 1-352aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 43.3 kDa
UniProt: Q487H6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDI
Anwendungsbeschreibung: Biological Origin: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-352aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.