Bacterial DINB protein

Product Overview

• Article Name: Bacterial DINB protein
• Biozol Catalog Number: BYT-ORB419075
• Supplier Catalog Number: orb419075
• Alternative Catalog Number: BYT-ORB419075-1,BYT-ORB419075-100,BYT-ORB419075-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7

Product Description

This Bacterial DINB protein spans the amino acid sequence from region 1-352aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 43.3 kDa
• UniProt: Q487H6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDI

Application Notes

• Application Notes: Biological Origin: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-352aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.