E. coli PHRB protein
Artikelnummer:
BYT-ORB419092
- Bilder (3)
| Artikelname: | E. coli PHRB protein |
| Artikelnummer: | BYT-ORB419092 |
| Hersteller Artikelnummer: | orb419092 |
| Alternativnummer: | BYT-ORB419092-1,BYT-ORB419092-100,BYT-ORB419092-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | DNA photolyase Photoreactivating enzyme |
| This E. coli PHRB protein spans the amino acid sequence from region 1-472aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 73.7 kDa |
| UniProt: | P00914 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Escherichia coli (strain K12) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MTTHLVWFRQDLRLHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKVRSSGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLATGGLSPRQCLHR |
| Anwendungsbeschreibung: | Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-472aaSequence Info: Full Length |



