E. coli PHRB protein
Catalog Number:
BYT-ORB419092
- Images (3)
| Article Name: | E. coli PHRB protein |
| Biozol Catalog Number: | BYT-ORB419092 |
| Supplier Catalog Number: | orb419092 |
| Alternative Catalog Number: | BYT-ORB419092-20,BYT-ORB419092-100,BYT-ORB419092-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | DNA photolyase Photoreactivating enzyme |
| This E. coli PHRB protein spans the amino acid sequence from region 1-472aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 73.7 kDa |
| UniProt: | P00914 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Escherichia coli (strain K12) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTTHLVWFRQDLRLHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKVRSSGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLATGGLSPRQCLHR |
| Application Notes: | Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-472aaSequence Info: Full Length |



