Human CTAG1A protein

Artikelnummer: BYT-ORB419096
Artikelname: Human CTAG1A protein
Artikelnummer: BYT-ORB419096
Hersteller Artikelnummer: orb419096
Alternativnummer: BYT-ORB419096-20,BYT-ORB419096-100,BYT-ORB419096-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1
This Human CTAG1A protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 21.5 kDa
UniProt: P78358
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 1-180aaSequence Info: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CTAG1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CTAG1A.