Human CTAG1A protein

Product Overview

• Article Name: Human CTAG1A protein
• Biozol Catalog Number: BYT-ORB419096
• Supplier Catalog Number: orb419096
• Alternative Catalog Number: BYT-ORB419096-1,BYT-ORB419096-100,BYT-ORB419096-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1

Product Description

This Human CTAG1A protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 21.5 kDa
• UniProt: P78358
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 1-180aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CTAG1A.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CTAG1A.