Human CYSRT1 protein

Artikelnummer: BYT-ORB419103
Artikelname: Human CYSRT1 protein
Artikelnummer: BYT-ORB419103
Hersteller Artikelnummer: orb419103
Alternativnummer: BYT-ORB419103-1,BYT-ORB419103-100,BYT-ORB419103-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: /
Recombinant Human cysteine-rich tail 1
Molekulargewicht: 25.2 kDa
UniProt: B8A4K4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Anwendungsbeschreibung: Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 1-184aaSequence Info: Partial