Human CYSRT1 protein

Catalog Number: BYT-ORB419103
Article Name: Human CYSRT1 protein
Biozol Catalog Number: BYT-ORB419103
Supplier Catalog Number: orb419103
Alternative Catalog Number: BYT-ORB419103-1,BYT-ORB419103-100,BYT-ORB419103-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: /
Recombinant Human cysteine-rich tail 1
Molecular Weight: 25.2 kDa
UniProt: B8A4K4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPPLPRREKAAASRSTQALGPRAQKTERTDCRVATTGWTMDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Application Notes: Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 1-184aaSequence Info: Partial