Human SLC8A1 protein

Artikelnummer: BYT-ORB419107
Artikelname: Human SLC8A1 protein
Artikelnummer: BYT-ORB419107
Hersteller Artikelnummer: orb419107
Alternativnummer: BYT-ORB419107-1,BYT-ORB419107-100,BYT-ORB419107-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: Na(+)/Ca(2+)-exchange protein 1 Solute carrier family 8 member 1
Recombinant Human Sodium/calcium exchanger 1
Molekulargewicht: 27.4 kDa
UniProt: P32418
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG
Anwendungsbeschreibung: Tag Info: N-terminal 6xHis-taggedExpression Region: 396-627aaSequence Info: Full Length