Human SLC8A1 protein

Catalog Number: BYT-ORB419107
Article Name: Human SLC8A1 protein
Biozol Catalog Number: BYT-ORB419107
Supplier Catalog Number: orb419107
Alternative Catalog Number: BYT-ORB419107-1,BYT-ORB419107-100,BYT-ORB419107-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Na(+)/Ca(2+)-exchange protein 1 Solute carrier family 8 member 1
Recombinant Human Sodium/calcium exchanger 1
Molecular Weight: 27.4 kDa
UniProt: P32418
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG
Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 396-627aaSequence Info: Full Length