Bacterial MTR protein
Artikelnummer:
BYT-ORB419127
- Bilder (3)
| Artikelname: | Bacterial MTR protein |
| Artikelnummer: | BYT-ORB419127 |
| Hersteller Artikelnummer: | orb419127 |
| Alternativnummer: | BYT-ORB419127-20,BYT-ORB419127-100,BYT-ORB419127-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Mycothiol-disulfide reductase NADPH-dependent mycothione reductase |
| This Bacterial MTR protein spans the amino acid sequence from region 1-459aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 69.9 kDa |
| UniProt: | P9WHH2 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDVVSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYHTSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQRGSGVALRLDDGCTI |
| Anwendungsbeschreibung: | Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-459aaSequence Info: Partial |



