Bacterial MTR protein
Catalog Number:
BYT-ORB419127
- Images (3)
| Article Name: | Bacterial MTR protein |
| Biozol Catalog Number: | BYT-ORB419127 |
| Supplier Catalog Number: | orb419127 |
| Alternative Catalog Number: | BYT-ORB419127-1,BYT-ORB419127-100,BYT-ORB419127-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Mycothiol-disulfide reductase NADPH-dependent mycothione reductase |
| This Bacterial MTR protein spans the amino acid sequence from region 1-459aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 69.9 kDa |
| UniProt: | P9WHH2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDVVSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYHTSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQRGSGVALRLDDGCTI |
| Application Notes: | Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-459aaSequence Info: Partial |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) mtr. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) mtr. |
Product Guarantee and Expert Support
