Human SFTPB protein

Produktübersicht

• Artikelname: Human SFTPB protein
• Artikelnummer: BYT-ORB419270
• Hersteller Artikelnummer: orb419270
• Alternativnummer: BYT-ORB419270-100,BYT-ORB419270-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Produktbeschreibung

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 24.7 kDa
• UniProt: P07988
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 201-279aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of SFTPB was greater than 90% as determined by SEC-HPLC.