Human SFTPB protein

Catalog Number: BYT-ORB419270
Article Name: Human SFTPB protein
Biozol Catalog Number: BYT-ORB419270
Supplier Catalog Number: orb419270
Alternative Catalog Number: BYT-ORB419270-100,BYT-ORB419270-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)
This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.7 kDa
UniProt: P07988
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 201-279aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of SFTPB was greater than 90% as determined by SEC-HPLC.