Mouse ADAM12 protein

Artikelnummer: BYT-ORB419288
Artikelname: Mouse ADAM12 protein
Artikelnummer: BYT-ORB419288
Hersteller Artikelnummer: orb419288
Alternativnummer: BYT-ORB419288-1,BYT-ORB419288-100,BYT-ORB419288-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Meltrin-alpha
This Mouse ADAM12 protein spans the amino acid sequence from region 206-706aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.4 kDa
UniProt: Q61824
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDA
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 206-706aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.