Mouse ADAM12 protein

Product Overview

• Article Name: Mouse ADAM12 protein
• Biozol Catalog Number: BYT-ORB419288
• Supplier Catalog Number: orb419288
• Alternative Catalog Number: BYT-ORB419288-1,BYT-ORB419288-100,BYT-ORB419288-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Meltrin-alpha

Product Description

This Mouse ADAM12 protein spans the amino acid sequence from region 206-706aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 58.4 kDa
• UniProt: Q61824
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDA

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 206-706aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.