Mouse IL36G protein

Artikelnummer: BYT-ORB419313
Artikelname: Mouse IL36G protein
Artikelnummer: BYT-ORB419313
Hersteller Artikelnummer: orb419313
Alternativnummer: BYT-ORB419313-10,BYT-ORB419313-100,BYT-ORB419313-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-1 family member 9,
This Mouse IL36G protein spans the amino acid sequence from region 13-164aa. Purity: > 98% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 17.3 kDa
UniProt: Q8R460
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20
Quelle: Mus musculus (Mouse)
Reinheit: > 98% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 5 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein
orb419313
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.