Mouse IL36G protein

Product Overview

• Article Name: Mouse IL36G protein
• Biozol Catalog Number: BYT-ORB419313
• Supplier Catalog Number: orb419313
• Alternative Catalog Number: BYT-ORB419313-10,BYT-ORB419313-100,BYT-ORB419313-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Interleukin-1 family member 9,

Product Description

This Mouse IL36G protein spans the amino acid sequence from region 13-164aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 17.3 kDa
• UniProt: Q8R460
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20
• Source: Mus musculus (Mouse)
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 5 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein

Images

orb419313

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.