Primate IFN gamma protein

Artikelnummer: BYT-ORB419314
Artikelname: Primate IFN gamma protein
Artikelnummer: BYT-ORB419314
Hersteller Artikelnummer: orb419314
Alternativnummer: BYT-ORB419314-10,BYT-ORB419314-100,BYT-ORB419314-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IFN-gamma,
This Primate IFN gamma protein spans the amino acid sequence from region 24-165aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 16.8 kDa
UniProt: P63310
Puffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: > 97% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 x 10 4 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 24-165aaSequence Info: Full Length of Mature Protein
orb419314
orb419314