Primate IFN gamma protein

Product Overview

• Article Name: Primate IFN gamma protein
• Biozol Catalog Number: BYT-ORB419314
• Supplier Catalog Number: orb419314
• Alternative Catalog Number: BYT-ORB419314-10,BYT-ORB419314-100,BYT-ORB419314-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IFN-gamma,

Product Description

This Primate IFN gamma protein spans the amino acid sequence from region 24-165aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 16.8 kDa
• UniProt: P63310
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Macaca mulatta (Rhesus macaque)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Application Notes

• Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0 x 10 4 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 24-165aaSequence Info: Full Length of Mature Protein

Images

orb419314

orb419314