Human FGF1 protein

Artikelnummer: BYT-ORB419317
Artikelname: Human FGF1 protein
Artikelnummer: BYT-ORB419317
Hersteller Artikelnummer: orb419317
Alternativnummer: BYT-ORB419317-10,BYT-ORB419317-100,BYT-ORB419317-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1
This Human FGF1 protein spans the amino acid sequence from region 1-155aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 17.5 kDa
UniProt: P05230
Puffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose
Quelle: Homo sapiens (Human)
Reinheit: > 97% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 6 IU/mg in the presence of 10 µg/ml of heparin. Application Notes: Tag Info: NO-taggedExpression Region: 1-155aaSequence Info: Full Length of Mature Protein
SDS-PAGE analysis of Human FGF1 protein
orb419317