Human FGF1 protein

Product Overview

• Article Name: Human FGF1 protein
• Biozol Catalog Number: BYT-ORB419317
• Supplier Catalog Number: orb419317
• Alternative Catalog Number: BYT-ORB419317-10,BYT-ORB419317-100,BYT-ORB419317-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: FGF-1, aFGF, Endothelial cell growth factor, ECGF, Heparin-binding growth factor 1

Product Description

This Human FGF1 protein spans the amino acid sequence from region 1-155aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 17.5 kDa
• UniProt: P05230
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 2 mM EDTA, 0.5 mM DTT, 5 % Trehalose
• Source: Homo sapiens (Human)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 6 IU/mg in the presence of 10 µg/ml of heparin. Application Notes: Tag Info: NO-taggedExpression Region: 1-155aaSequence Info: Full Length of Mature Protein

Images

SDS-PAGE analysis of Human FGF1 protein

orb419317