Human VEGFA protein

Artikelnummer: BYT-ORB419318
Artikelname: Human VEGFA protein
Artikelnummer: BYT-ORB419318
Hersteller Artikelnummer: orb419318
Alternativnummer: BYT-ORB419318-10,BYT-ORB419318-100,BYT-ORB419318-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: VEGF-A, VPF
This Human VEGFA protein spans the amino acid sequence from region 27-191aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 19.3 kDa
UniProt: P15692
Puffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
Quelle: Homo sapiens (Human)
Reinheit: > 97% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. Application Notes: Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length
SDS-PAGE analysis of Human VEGFA protein
orb419318