Human VEGFA protein

Product Overview

• Article Name: Human VEGFA protein
• Biozol Catalog Number: BYT-ORB419318
• Supplier Catalog Number: orb419318
• Alternative Catalog Number: BYT-ORB419318-10,BYT-ORB419318-100,BYT-ORB419318-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: VEGF-A, VPF

Product Description

This Human VEGFA protein spans the amino acid sequence from region 27-191aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 19.3 kDa
• UniProt: P15692
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
• Source: Homo sapiens (Human)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. Application Notes: Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length

Images

SDS-PAGE analysis of Human VEGFA protein

orb419318