Human SPRC protein

Artikelnummer: BYT-ORB419320
Artikelname: Human SPRC protein
Artikelnummer: BYT-ORB419320
Hersteller Artikelnummer: orb419320
Alternativnummer: BYT-ORB419320-10,BYT-ORB419320-100,BYT-ORB419320-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine,
This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 32.7 kDa
UniProt: P09486
Puffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: > 98% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFET
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2
SDS-PAGE analysis of Human SPRC protein
orb419320