Human SPRC protein

Product Overview

• Article Name: Human SPRC protein
• Biozol Catalog Number: BYT-ORB419320
• Supplier Catalog Number: orb419320
• Alternative Catalog Number: BYT-ORB419320-10,BYT-ORB419320-100,BYT-ORB419320-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine,

Product Description

This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 32.7 kDa
• UniProt: P09486
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Homo sapiens (Human)
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFET

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2

Images

SDS-PAGE analysis of Human SPRC protein

orb419320