Rabbit GHBP Protein

Artikelnummer: BYT-ORB425721
Artikelname: Rabbit GHBP Protein
Artikelnummer: BYT-ORB425721
Hersteller Artikelnummer: orb425721
Alternativnummer: BYT-ORB425721-1, BYT-ORB425721-20, BYT-ORB425721-5
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GHR, GHBP, GH receptor, Somatotropin receptor.
Recombinant of rabbit GHBP protein
Puffer: The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.
Reinheit: Greater than 98.0% as determined bySDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. Application Notes: Cytokines And Growth Factors