Rabbit GHBP Protein

Product Overview

• Article Name: Rabbit GHBP Protein
• Biozol Catalog Number: BYT-ORB425721
• Supplier Catalog Number: orb425721
• Alternative Catalog Number: BYT-ORB425721-1, BYT-ORB425721-20, BYT-ORB425721-5
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: GHR, GHBP, GH receptor, Somatotropin receptor.

Product Description

Recombinant of rabbit GHBP protein

Product Properties

• Buffer: The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.
• Purity: Greater than 98.0% as determined bySDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP

Application Notes

• Application Notes: Solubility: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. Application Notes: Cytokines And Growth Factors