Human GMFB Protein

Artikelnummer: BYT-ORB425791
Artikelname: Human GMFB Protein
Artikelnummer: BYT-ORB425791
Hersteller Artikelnummer: orb425791
Alternativnummer: BYT-ORB425791-1, BYT-ORB425791-10, BYT-ORB425791-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Recombinant of human GMFB protein
Puffer: The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Reinheit: Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized GMFB in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Cytokines And Growth Factors