Human GMFB Protein

Product Overview

• Article Name: Human GMFB Protein
• Biozol Catalog Number: BYT-ORB425791
• Supplier Catalog Number: orb425791
• Alternative Catalog Number: BYT-ORB425791-1, BYT-ORB425791-10, BYT-ORB425791-2
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.

Product Description

Recombinant of human GMFB protein

Product Properties

• Buffer: The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
• Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH

Application Notes

• Application Notes: Solubility: It is recommended to reconstitute the lyophilized GMFB in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Cytokines And Growth Factors