Human GNLY Protein

Artikelnummer: BYT-ORB425811
Artikelname: Human GNLY Protein
Artikelnummer: BYT-ORB425811
Hersteller Artikelnummer: orb425811
Alternativnummer: BYT-ORB425811-1, BYT-ORB425811-10, BYT-ORB425811-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Recombinant of human GNLY protein
Puffer: The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Reinheit: Greater than 95.0% as determined by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized Granulysin in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Recombinant & Natural Proteins