Human GNLY Protein

Product Overview

• Article Name: Human GNLY Protein
• Biozol Catalog Number: BYT-ORB425811
• Supplier Catalog Number: orb425811
• Alternative Catalog Number: BYT-ORB425811-1, BYT-ORB425811-10, BYT-ORB425811-2
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.

Product Description

Recombinant of human GNLY protein

Product Properties

• Buffer: The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH

Application Notes

• Application Notes: Solubility: It is recommended to reconstitute the lyophilized Granulysin in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Recombinant & Natural Proteins